PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A03G0327
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 269aa    MW: 30807.7 Da    PI: 8.1961
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A03G0327genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.5e-171057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed  lv+ v+++G ++W+ Ia+  g++Rt+k+c++rw +yl
      Gh_A03G0327 10 KGPWTEQEDAVLVNFVHLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 57
                     79********************************************97 PP

2Myb_DNA-binding50.74e-1663108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      r +++++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
      Gh_A03G0327  63 REKMSPQEQRLVLELHAKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 108
                      6799******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.923557IPR017930Myb domain
SMARTSM007172.8E-15959IPR001005SANT/Myb domain
SuperFamilySSF466893.45E-299104IPR009057Homeodomain-like
PfamPF002499.3E-161057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-201164IPR009057Homeodomain-like
CDDcd001677.67E-111257No hitNo description
PROSITE profilePS5129425.81458112IPR017930Myb domain
SMARTSM007178.9E-1662110IPR001005SANT/Myb domain
PfamPF002491.6E-1463107IPR001005SANT/Myb domain
CDDcd001673.84E-1165108No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2265111IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MKAEQEETRK GPWTEQEDAV LVNFVHLFGD RRWDFIAKVS GLNRTGKSCR LRWVNYLHPG  60
LKREKMSPQE QRLVLELHAK WGNRWSRIAR KLPGRTDNEI KNYWRTHMRK KAQEKKKDMP  120
KSLSPSSSSS SSITLSSSSS TTTTTTTTTV DSLPFSGTGK VSFYDTGGPK MAALGDKSST  180
DFKDEKGYYS MDDIWKDIDM SEENMIKPLS HNYSEEGCNI FCPSMASPSL DYCWDSLWKM  240
DDEESKMFLP FSQSISCFEY GTSIFNQIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-2871121105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591436e-75AJ459143.1 Gossypium hirsutum partial myb115c gene, clone pGhMYB115c.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012471406.11e-175PREDICTED: transcription factor MYB59 isoform X1
SwissprotQ9LX822e-98MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A0B0NST80.0A0A0B0NST8_G
STRINGVIT_06s0004g04140.t011e-112(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25022774
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.12e-95myb domain protein 48